MUTE MSHIAVERNRRRQMNEHLKSLRSLTPCFYIKRGDQASIIGGVIEFIKELQQLVQVLESKKRRKTLNRPSFPYDHQTIEPSSLGAATTRVPFSRIENVMTTSTFKEVGACCNSPHANVEAKISGSNVVLRVVSRRIVGQLVKIISVLEKLSFQVLHLNISSMEETVLYFFVVKIGLECHLSLEELTLEVQKSFVSDEVIVSTN EN20 Basic helix-loop-helix protein 45 Transcription factor. Together with FMA and SPCH, regulates the stomata formation. Required for the differentiation of stomatal guard cells, by promoting successive asymmetric cell divisions and the formation of guard mother cells. Promotes the conversion of the leaf epidermis into stomata. Transcription factor MUTE F28L1.6 bHLH transcription factor bHLH045 At3g06120 202 MUTE_ARATH Transcription factor EN 20 BHLH45